PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G110700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 333aa    MW: 36140.9 Da    PI: 8.6979
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G110700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.4e-145195147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +W +eE+ +++da  ++G + Wk+I +++  ++t+ q++s+ qky
  Seita.5G110700.1.p 51 REPWRAEEHGRFLDALLMFGRD-WKKIEEHVR-TKTAVQIRSHAQKY 95
                        789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-74596IPR009057Homeodomain-like
SuperFamilySSF466891.42E-1545101IPR009057Homeodomain-like
PROSITE profilePS5129416.14146100IPR017930Myb domain
TIGRFAMsTIGR015572.2E-154998IPR006447Myb domain, plants
SMARTSM007171.6E-85098IPR001005SANT/Myb domain
PfamPF002492.0E-115195IPR001005SANT/Myb domain
CDDcd001675.61E-75396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MARVSIYTVH QPGFLGGSHW HCIRFVEGME RGSDEVPGKK ARKPYTTTKP REPWRAEEHG  60
RFLDALLMFG RDWKKIEEHV RTKTAVQIRS HAQKYFLKVQ KLGLAAGLPP MHPRRRFSME  120
QQSSAPAAGS SAAAVPLLHE ELQRAPVAVP PGPSGAAVAH GCISWNRNSP GVLPVASSSE  180
MQHGLDWAGG SASGARAWLN SDAQSQSSPL PGGSQFIGAP SFSSTSMEWA GSSTSGGSAT  240
GSVQEELIEL PLSPDDLHFA QVYRFVGDVF DPNAPIPVEA HLQKLKDMDD ITVKTILLVL  300
RNLEDNLSAP QFEPIRRLLS TYDPRRGLSG QL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0693306e-57BT069330.2 Zea mays full-length cDNA clone ZM_BFc0100G09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971681.10.0PREDICTED: protein REVEILLE 8-like isoform X2
TrEMBLK3XLD11e-144K3XLD1_SETIT; Uncharacterized protein
STRINGSi002704m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.13e-29MYB_related family protein